PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676748218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family bZIP
Protein Properties Length: 457aa    MW: 49683.3 Da    PI: 9.7052
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676748218genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_124.84.8e-08322381564
                CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC CS
     bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkseve 64 
                kr  r   NR +A rs  +  + + eLe kv++L++eN aL   ++  + e  +l+ e++
  676748218 322 KRVERILANRKSAARSKDKQAQFVYELEAKVDALKTENAALTAHIKLVERERLALEEENK 381
                67778889*******************************************999999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-8318382IPR004827Basic-leucine zipper domain
PfamPF077166.4E-7320372IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.829320383IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.82E-8322377No hitNo description
Gene3DG3DSA:1.20.5.1707.8E-9322383No hitNo description
CDDcd147031.52E-13323368No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MNRHAEIAPL NTSFVHSTHF PSPPANGRTE SGKRDDMSTP RRSSLPPLPL SSLIPRTPQP  60
TGLENFNPGP RISRQPSPAP AFSFGSLPPM SSAPTSFTDT QSTPVAYHNA ALPPLPVTRP  120
NASGVSRTAL PPRKIHRRAN SDSVSSTNPL MPKGGMRMVY PRPVEMPVGV TKAKESSGGQ  180
ESDEEDDANA YMDISDNNFN ISNEEGGDRI SRDSENGKTN GSENGRKATS GVKRSRRAGK  240
EISPSSSRIS SESISVDSNL NGKSSSSGGE LPPSPGNLQG VTNSVDGNEN ASQTEKYKFN  300
AYDLQQIMRS EKLKAMVVTN PKRVERILAN RKSAARSKDK QAQFVYELEA KVDALKTENA  360
ALTAHIKLVE RERLALEEEN KHLRIRVEGM MEHARLCDAF MGYLTGEVNQ LKKTNVEVLP  420
NSSEYGRSNG QSVNGDMLQQ LNVGQPNQQP QTNLGLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42242757
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.32e-33bZIP family protein